- LRCH4 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-81288
- Human
- LRCH4
- Unconjugated
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: LPIAGPATAP APRPLGSIQR PNSFLFRSSS QSGSGPSSPD SVLRPRRYPQ VPDEKDLMTQ LRQVLESRLQ
- PBS (pH 7.2) and 40% Glycerol
- LRN, LRRN1, LRRN4, PP14183
- leucine rich repeats and calponin homology domain containing 4
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
LPIAGPATAPAPRPLGSIQRPNSFLFRSSSQSGSGPSSPDSVLRPRRYPQVPDEKDLMTQLRQVLESRLQ
Specifications/Features
Available conjugates: Unconjugated